General Information

  • ID:  hor006389
  • Uniprot ID:  P07660
  • Protein name:  Calcitonin
  • Gene name:  CALCA
  • Organism:  Gallus gallus (Chicken)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria , Theropoda , Saurischia , Dinosauria , Archosauria , Archelosauria , Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP
  • Length:  32
  • Propeptide:  MVMLKISSFLAVYALVVCQMDSFQAAPVRPGLESITDRVTLSDYEARRLLNALVKDFIQMTAEELEQASEGNSLDRPISKRCASLSTCVLGKLSQELHKLQTYPRTDVGAGTPGKKRNVLNDLDHERYANYGETLGNN
  • Signal peptide:  MVMLKISSFLAVYALVVCQMDSFQA
  • Modification:  T32 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CALCRL
  • Target Unid:  C5HV42
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-7
  • Structure ID:  AF-P07660-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006389_AF2.pdbhor006389_ESM.pdb

Physical Information

Mass: 392801 Formula: C145H241N41O47S2
Absent amino acids: FIMNW Common amino acids: L
pI: 8.23 Basic residues: 4
Polar residues: 13 Hydrophobic residues: 9
Hydrophobicity: -13.75 Boman Index: -3623
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 85.31
Instability Index: 2253.75 Extinction Coefficient cystines: 1615
Absorbance 280nm: 52.1

Literature

  • PubMed ID:  3666142
  • Title:  Sequence and expression of the chicken calcitonin gene.
  • PubMed ID:  4054101
  • Title:  Elucidation of the nucleotide sequence of chicken calcitonin mRNA: direct evidence for the expression of a lower vertebrate calcitonin-like gene in man and rat.
  • PubMed ID:  3838160
  • Title:  Structure of chicken calcitonin predicted by partial nucleotide sequence of its precursor.
  • PubMed ID:  3782060
  • Title:  Isolation and determination of the amino acid sequence of chicken calcitonin I from chicken ultimobranchial glands.